DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Srsf1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001103022.1 Gene:Srsf1 / 689890 RGDID:1587490 Length:248 Species:Rattus norvegicus


Alignment Length:256 Identity:66/256 - (25%)
Similarity:95/256 - (37%) Gaps:86/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GGGVAARDRSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCG----I 102
            ||||......  ..:||:|:.|:|.|.|.:|::|:|.: .|:|..:.|      |.|..|    .
  Rat     3 GGGVIRGPAG--NNDCRIYVGNLPPDIRTKDIEDVFYK-YGAIRDIDL------KNRRGGPPFAF 58

  Fly   103 VEFKDPENVQKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNG 167
            |||:||.:.:.|:...:.|:.:|..|.|:            ..|.|.|.|.||||         |
  Rat    59 VEFEDPRDAEDAVYGRDGYDYDGYRLRVE------------FPRSGRGTGRGGGG---------G 102

  Fly   168 GGGGGGRDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHN 232
            ||||..|                   ||                  ||..:...|         |
  Rat   103 GGGGAPR-------------------GR------------------YGPPSRRSE---------N 121

  Fly   233 KVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLD 293
            :|.|:.|......:.||...:.||.|...|:..|      |..|:|:....:...|:..||
  Rat   122 RVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRD------GTGVVEFVRKEDMTYAVRKLD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 62/250 (25%)
RRM1_hnRNPM_like 58..133 CDD:240831 25/78 (32%)
RRM2_hnRNPM_like 234..307 CDD:240832 16/60 (27%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Srsf1NP_001103022.1 RRM1_SRSF1 12..90 CDD:410010 26/98 (27%)
RRM2_SRSF1 113..196 CDD:410160 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.