DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Cstf2

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_038955991.1 Gene:Cstf2 / 683927 RGDID:1596566 Length:624 Species:Rattus norvegicus


Alignment Length:517 Identity:105/517 - (20%)
Similarity:164/517 - (31%) Gaps:174/517 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GVAARDRSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFD-ESGKARGCGIVEFKD 107
            |:..||.:.:|....|::.||||:...:.|||:|.. ||.:...:|.:| |:||.:|.|..|::|
  Rat     3 GLPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSE-VGPVVSFRLVYDRETGKPKGYGFCEYQD 66

  Fly   108 PENVQKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGG 172
            .|....|:..:|..|.:||.|                                            
  Rat    67 QETALSAMRNLNGREFSGRAL-------------------------------------------- 87

  Fly   173 GRDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVF-- 235
                          |.|:..|.:|.                     ..|:|||...|:....:  
  Rat    88 --------------RVDNAASEKNK---------------------EELKSLGTGAPVIESPYGE 117

  Fly   236 -------VANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSR-------GFAVIEYDHPVEAV 286
                   ..::...|.:...:|:|:|..:::....:..:|..:.       .:|:::....:..|
  Rat   118 SISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIV 182

  Fly   287 Q---AISMLDRQMLFDRRMTVRLDRIPDKNEGIKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQ 348
            .   |:.:|.||           ..||....|  .|:.:...|.|.|||      |:.|..|...
  Rat   183 DPEIALKILHRQ-----------TNIPTLISG--NPQPVHVAGPGSGPN------VSMNQQNPQA 228

  Fly   349 SQGQLLGN--------AQQGSQLGSV-----------GSQPNSSA---VSNATTNLLNNLTGVMF 391
            .|.|.|..        ..|.|..|.|           |..|.|.|   |..|...:.......|.
  Rat   229 PQAQSLSGMHVNGAPPMMQASMPGGVPAPVQMAAAVAGPGPGSLAPAGVMQAQVGMQGAGPVPME 293

  Fly   392 GNHAAVQPSPVAPVQKPSL----GNNTGSGGLNLNNLNPSILAAVVGNL-GNQGGNLSNPLLSSS 451
            .....:|.|||.|....|:    |..|.....::....||:|  |.|.| |.....:.:|..:..
  Rat   294 RGQGTLQHSPVGPAGPASIERVQGQRTWMIWASVRGSTPSLL--VSGGLDGIAVLPMQDPRAAMQ 356

  Fly   452 LSNLGLN-------LGNSGNDDN-------------------LPPSNVGLSNNYSSGGTGGG 487
            ...|..|       ||::.||..                   .||.:.|...::..|..|.|
  Rat   357 RGALPANVPTPRGLLGDAPNDPRGGTLMTVTGEVEPRAYLGPPPPPHQGPPMHHVPGHEGRG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 88/432 (20%)
RRM1_hnRNPM_like 58..133 CDD:240831 27/75 (36%)
RRM2_hnRNPM_like 234..307 CDD:240832 11/91 (12%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Cstf2XP_038955991.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/142 (21%)
CSTF2_hinge 112..191 CDD:405077 8/78 (10%)
PRK14718 <444..>501 CDD:173181
CSTF_C 580..620 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.