DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and SNRNP70

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_003080.2 Gene:SNRNP70 / 6625 HGNCID:11150 Length:437 Species:Homo sapiens


Alignment Length:200 Identity:51/200 - (25%)
Similarity:86/200 - (43%) Gaps:32/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ESREK--ERDRRGRGARGSRFTDAD----GNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYDY 68
            |:||:  ||.||.:..|..:..:.:    ...|...:||.....           ::::.:.||.
Human    61 ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT-----------LFVARVNYDT 114

  Fly    69 RWQDLKDLFRRIVGSIEYVQLFFDE-SGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKE 132
            ....|:..| .:.|.|:.:.:.:.: |||.||...:|::...::..|.:..:..:::||.::|..
Human   115 TESKLRREF-EVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDV 178

  Fly   133 DHGEQRDQYG-RIVRDGGGGGG---GGGGVQGGNGGNNGGG------GGGGRDHMD-DRDRGFSR 186
            :.|  |...| |..|.|||.||   ||..|...:.|.:...      |.....|.| ||||...|
Human   179 ERG--RTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERER 241

  Fly   187 RDDDR 191
            |:..|
Human   242 RERSR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 39/155 (25%)
RRM1_hnRNPM_like 58..133 CDD:240831 16/75 (21%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
SNRNP70NP_003080.2 U1snRNP70_N 3..93 CDD:403437 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..79 8/17 (47%)
Required for interaction with U1 RNA. /evidence=ECO:0000269|PubMed:2467746 92..202 29/123 (24%)
RRM_snRNP70 102..187 CDD:409682 18/98 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..437 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.