DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and SRSF4

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_005617.2 Gene:SRSF4 / 6429 HGNCID:10786 Length:494 Species:Homo sapiens


Alignment Length:201 Identity:52/201 - (25%)
Similarity:82/201 - (40%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ARGSRFTDADGN-GNGAGSQGGGVAARDR--SRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSI 84
            |||.|   .||: |:|....|...:.||:  ...|...|:.:.|:.....||||||..|: .|.:
Human    70 ARGPR---RDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQ-AGEV 130

  Fly    85 EYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKEDH--GEQRDQYGRI--- 144
            .|.    |.....:..|::||....::::||||::..|||||::.:.||.  ..:|..|.|.   
Human   131 TYA----DAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSRRRRSYSRSRSH 191

  Fly   145 ------VRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRNNFNMMSN 203
                  .|.........|..:..:..:......|.|.....|.|..||....:...|:.....|.
Human   192 SRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEKSR 256

  Fly   204 DYNNSS 209
            ..::|:
Human   257 SRSHSA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 43/175 (25%)
RRM1_hnRNPM_like 58..133 CDD:240831 24/74 (32%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
SRSF4NP_005617.2 RRM1_SRSF4_like 3..72 CDD:240783 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..95 8/25 (32%)
RRM2_SRSF4_like 104..175 CDD:241044 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..494 16/94 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.