DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and SRSF3

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:80 Identity:27/80 - (33%)
Similarity:43/80 - (53%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISM 291
            |.||..||:|.||....:..:|::.|...|.::||.::    .|..|||.:|::.|.:|..|:..
Human     5 SCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVA----RNPPGFAFVEFEDPRDAADAVRE 65

  Fly   292 LDRQMLFDRRMTVRL 306
            ||.:.|...|:.|.|
Human    66 LDGRTLCGCRVRVEL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 27/80 (34%)
RRM1_hnRNPM_like 58..133 CDD:409819
RRM2_hnRNPM_like 234..307 CDD:409820 23/73 (32%)
RRM_SF 565..629 CDD:473069
SRSF3NP_003008.1 Sufficient for interaction with NXF1 and SRSP. /evidence=ECO:0000269|PubMed:12667464, ECO:0000269|PubMed:17036044, ECO:0000269|PubMed:32440474 1..90 27/80 (34%)
RRM_SRSF3 6..86 CDD:241089 26/79 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 27/80 (34%)
2 X approximate repeats, basic 119..164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.