DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and srsf6b

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001008732.1 Gene:srsf6b / 494133 ZFINID:ZDB-GENE-041219-1 Length:355 Species:Danio rerio


Alignment Length:130 Identity:42/130 - (32%)
Similarity:67/130 - (51%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ARGSRFTDADGNGNGAGSQGG----GVAARDRSRE-------RRNCRVYISNIPYDYRWQDLKDL 76
            |||.| .|.||.|.|.|..||    |.::|.||..       |...|:.:.|:.....|||||| 
Zfish    70 ARGPR-RDRDGYGGGYGGFGGRSNSGYSSRSRSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKD- 132

  Fly    77 FRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKEDHGEQRDQY 141
            |.|..|.:.|.....:.:.:    |::||:...::::||:|::..::|||::.:.||...:|..|
Zfish   133 FMRQAGEVTYADAHKERTNE----GVIEFRSHSDMRRALDKLDVTDINGRKIRLVEDKPRRRRSY 193

  Fly   142  141
            Zfish   194  193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 29/101 (29%)
RRM1_hnRNPM_like 58..133 CDD:240831 21/74 (28%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
srsf6bNP_001008732.1 RRM1_SRSF6 3..72 CDD:241040 1/1 (100%)