DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and srsf5b

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001002610.1 Gene:srsf5b / 436883 ZFINID:ZDB-GENE-040718-354 Length:285 Species:Danio rerio


Alignment Length:186 Identity:49/186 - (26%)
Similarity:73/186 - (39%) Gaps:30/186 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SREKERDRRGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYDYRWQDLKD 75
            :|.:.|..||||. |.||...    .|.|||.   :.|:....|...|:.:.|:.....||||||
Zfish    72 ARVRLRGGRGRGG-GGRFPAR----YGRGSQD---SRRNPPPMRTENRLIVENLSSRVSWQDLKD 128

  Fly    76 LFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKEDHGEQRDQ 140
             |.|..|.:    .|.|........|:|||....:::.||||::..|:|||::.:.|...::...
Zfish   129 -FMRQAGEV----TFADAHRPNLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLVEASRKKSRS 188

  Fly   141 YGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRN 196
            ..|                 .|..:.....|........|.|..|.:..:|...|:
Zfish   189 RSR-----------------SNSSSRSRSRGRSASRSRSRSRSHSPKSHNRSRSRS 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 36/149 (24%)
RRM1_hnRNPM_like 58..133 CDD:240831 25/74 (34%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621