DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and CstF64

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:86 Identity:34/86 - (39%)
Similarity:53/86 - (61%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ARDRSRERRNCR-VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFD-ESGKARGCGIVEFKDPE 109
            |:::|...::.| |::.||||:...:.||::|.. ||.:..::|.|| ||||.:|.|..|:||.|
  Fly     5 AQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSE-VGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68

  Fly   110 NVQKALEKMNRYEVNGRELVV 130
            ....|:..:|.||:.||.|.|
  Fly    69 TALSAMRNLNGYEIGGRTLRV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 33/85 (39%)
RRM1_hnRNPM_like 58..133 CDD:240831 32/75 (43%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
CstF64NP_477453.1 RRM <13..>112 CDD:223796 32/78 (41%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 31/73 (42%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.