DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and B52

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:106/271 - (39%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SREKERDRRG--RGARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYDYRWQDL 73
            :|::..||.|  ||..|.|:.:.:.|...:...|..:        |...|:.:.|:.....||||
  Fly    80 NRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPL--------RTEYRLIVENLSSRVSWQDL 136

  Fly    74 KDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKEDHGEQR 138
            ||..|: .|.:.|.    |...:.|..|:|||....:::.|:||::..|:|||.:.:.||.    
  Fly   137 KDYMRQ-AGEVTYA----DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDR---- 192

  Fly   139 DQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDH---MDDRDRGFSRRDDDRLSGRNNFNM 200
                                   .||.:|||||.||..   ...|.|..|||   |...|.:.:.
  Fly   193 -----------------------RGGRSGGGGGSGRGRSRSSSSRSRSRSRR---RSRSRRSSHS 231

  Fly   201 MSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSL 265
            .|...:.|.:......|.|.::|...|....||        ..|..|.|.  |...:.:|.....
  Fly   232 RSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNK--------SRDVSKSKS--KSHSRTRSRSPKR 286

  Fly   266 DKEGNSRGFAV 276
            :::..||..:|
  Fly   287 ERDSRSRSRSV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 59/232 (25%)
RRM1_hnRNPM_like 58..133 CDD:240831 24/74 (32%)
RRM2_hnRNPM_like 234..307 CDD:240832 8/43 (19%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783
RRM2_SRSF4_like 120..191 CDD:241044 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.