DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and tia1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:410 Identity:77/410 - (18%)
Similarity:130/410 - (31%) Gaps:117/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEV 123
            :|:.|:..|.....:..:|.:: |..:..::..|.:|....| .|||.:..:...:|..||..::
 Frog     9 LYVGNLSRDVTEPLILQVFSQL-GPCKSCKMIMDTAGNDPYC-FVEFFEHRHAAASLAAMNGRKI 71

  Fly   124 NGRELVV-----------------------KEDH-----GEQRDQ------------YGRI---- 144
            .|:|:.|                       .:||     |:...:            :|||    
 Frog    72 MGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDAR 136

  Fly   145 -VRDGGGGGGGGGGV-------QGGNG-GNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRNNFNM 200
             |:|...|...|.|.       ...|. ...||...|||   ..|....:|:..           
 Frog   137 VVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGR---QIRTNWATRKPP----------- 187

  Fly   201 MSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSL 265
                 ...|.|.......::.|.:..|.|.:..|:...:...:..:.::|.|...|::..|.:..
 Frog   188 -----APKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFP 247

  Fly   266 DKEGNSRGFAVIEYDHPVEAVQAISMLDRQML--------FDRRMTVRLDRIPDKNEG--IKLPE 320
            ||     |::.:.:.....|..||..::...:        :.:.....|:.:...:|.  |..|.
 Frog   248 DK-----GYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPDMLNPVQQVSEASQISFPP 307

  Fly   321 GLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQLLGNAQQGSQLGSVG----SQPNSSAVSNATTN 381
            ..|..|...|               |.|..||.:.|..|....|..|    .|..|...|:|.| 
 Frog   308 PYGQWGQWYG---------------GAQQIGQYVPNGWQMPAYGVYGQAWSQQGYSQTPSSAAT- 356

  Fly   382 LLNNLTGVMFGNHAAVQPSP 401
                    ..|.:..|||.|
 Frog   357 --------WVGPNYGVQPQP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 77/410 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831 17/96 (18%)
RRM2_hnRNPM_like 234..307 CDD:240832 11/80 (14%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027 17/73 (23%)
RRM2_TIA1 104..181 CDD:410030 18/79 (23%)
RRM3_TIAR 214..286 CDD:241064 11/76 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.