DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Srsf6

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001014207.2 Gene:Srsf6 / 362264 RGDID:1359241 Length:339 Species:Rattus norvegicus


Alignment Length:244 Identity:62/244 - (25%)
Similarity:99/244 - (40%) Gaps:40/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMDASNSV---ESREKERDR----RGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRE------ 53
            |.||.::|   .|:|...:|    ..||.|    .|.||...|:.|.|||.::|..|..      
  Rat    45 SRDADDAVYELNSKELCGERVIVEHARGPR----RDRDGYSYGSRSGGGGYSSRRTSGRDKYGPP 105

  Fly    54 -RRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEK 117
             |...|:.:.|:.....|||||| |.|..|.:.|.....:.:.:    |::||:...::::||:|
  Rat   106 VRTEYRLIVENLSSRCSWQDLKD-FMRQAGEVTYADAHKERTNE----GVIEFRSYSDMKRALDK 165

  Fly   118 MNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDR 182
            ::..|:|||.:.:.||......:     |...|........:.....:........|.....|.|
  Rat   166 LDGTEINGRNIRLIEDKPRTSHR-----RSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSR 225

  Fly   183 GFSR---RDDDRLSGRNNFNMM---------SNDYNNSSNYNLYGLSAS 219
            ..||   |...|..||.:.:..         |:.::.|.:.:.||.|.|
  Rat   226 SRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDKYGKSRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 44/191 (23%)
RRM1_hnRNPM_like 58..133 CDD:240831 22/74 (30%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Srsf6NP_001014207.2 RRM_SF 1..72 CDD:418427 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 10/27 (37%)
RRM2_SRSF6 110..182 CDD:410159 23/76 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.