DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Tial1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001013211.1 Gene:Tial1 / 361655 RGDID:1595845 Length:392 Species:Rattus norvegicus


Alignment Length:86 Identity:22/86 - (25%)
Similarity:38/86 - (44%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 ASRKSDT-----IIIKNVPITCTWQTLRDKFREIGDVKFAEI-------RGNDVGVVRFFKERDA 610
            :|:|.||     :.:.::....|.:.::..|...|.:..|.:       :....|.|.|:.:.||
  Rat   104 SSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDA 168

  Fly   611 ELAIALMDGSRLDGRNIKVTY 631
            |.||..|.|..|.||.|:..:
  Rat   169 ENAIVHMGGQWLGGRQIRTNW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689
RRM1_hnRNPM_like 58..133 CDD:240831
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796 22/84 (26%)
RRM_SF 565..630 CDD:302621 18/71 (25%)
Tial1NP_001013211.1 RRM1_TIAR 10..107 CDD:410028 1/2 (50%)
RRM2_TIAR 113..192 CDD:410029 18/77 (23%)
RRM3_TIAR 222..294 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.