DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Ref2

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:38/73 - (52%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 VFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLF 298
            |.|.||||.||:..:.::|...|.|:...:..|::|||.|.|.:.:.:..||.|.|.......|.
  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLD 141

  Fly   299 DRRMTVRL 306
            .||:.:.|
  Fly   142 GRRLKLHL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 25/73 (34%)
RRM1_hnRNPM_like 58..133 CDD:409819
RRM2_hnRNPM_like 234..307 CDD:409820 25/73 (34%)
RRM_SF 565..629 CDD:473069
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.