Sequence 1: | NP_649899.1 | Gene: | rump / 41138 | FlyBaseID: | FBgn0267790 | Length: | 632 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957161.1 | Gene: | srsf5a / 335396 | ZFINID: | ZDB-GENE-030131-7336 | Length: | 259 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 56/204 - (27%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 43/204 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 EKERDRRGRG---ARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYDYRWQDLK 74
Fly 75 DLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKEDHGEQRD 139
Fly 140 QYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSR-RDDDRLSGRNNFNMMSN 203
Fly 204 DYNNSSNYN 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rump | NP_649899.1 | PABP-1234 | 48..435 | CDD:130689 | 42/166 (25%) |
RRM1_hnRNPM_like | 58..133 | CDD:240831 | 25/74 (34%) | ||
RRM2_hnRNPM_like | 234..307 | CDD:240832 | |||
RRM | <543..>631 | CDD:223796 | |||
RRM_SF | 565..630 | CDD:302621 | |||
srsf5a | NP_957161.1 | RRM1_SRSF4_like | 5..72 | CDD:240783 | 1/1 (100%) |
RRM2_SRSF4_like | 113..184 | CDD:241044 | 25/75 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |