DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Rbp1-like

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:121 Identity:39/121 - (32%)
Similarity:58/121 - (47%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRY 121
            |:||:.|:.......::::.|.: .|.:..|.:..:..|.|    .|||:|..:.:.|...::..
  Fly    11 CKVYVGNLGSSASKYEIENAFSK-YGPLRNVWVARNPPGFA----FVEFEDRRDAEDATRGLDGT 70

  Fly   122 EVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGG---GGGGR 174
            ...|..:.|:...|..|:.     |.||||||||||..||.|...|.|   |||||
  Fly    71 RCCGTRIRVEMSSGRSREG-----RGGGGGGGGGGGGSGGGGRGGGSGARAGGGGR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 39/121 (32%)
RRM1_hnRNPM_like 58..133 CDD:409819 15/74 (20%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
Rbp1-likeNP_001188585.1 RRM_SRSF3_like 12..81 CDD:409808 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.