DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Tia1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_006236890.1 Gene:Tia1 / 312510 RGDID:1305742 Length:387 Species:Rattus norvegicus


Alignment Length:398 Identity:77/398 - (19%)
Similarity:130/398 - (32%) Gaps:135/398 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDE-SGKARGCGIVEFKDPENVQKALEKMNRYE 122
            :|:.|:..|.....:..||.:| |..:..::..|: :|....| .|||.:..:...||..||..:
  Rat     9 LYVGNLSRDVTEALILQLFSQI-GPCKNCKMIMDQTAGNDPYC-FVEFHEHRHAAAALAAMNGRK 71

  Fly   123 VNGRELVV---------KEDHGE------QRDQ-------------------------YGRI--- 144
            :.|:|:.|         |:|...      ||.|                         :|||   
  Rat    72 IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDA 136

  Fly   145 --VRDGGGGGGGGGG-------------VQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDD-DRLS 193
              |:|...|...|.|             :|     ..||...|||   ..|....:|:.. .:.:
  Rat   137 RVVKDMATGKSKGYGFVSFFNKWDAENAIQ-----QMGGQWLGGR---QIRTNWATRKPPAPKST 193

  Fly   194 GRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKV 258
            ..:|...:|.|                 |.:..|.|.:..|:...:...:..:.::|.|...|::
  Rat   194 YESNTKQLSYD-----------------EVVSQSSPGNCTVYCGGVTSGLTEQLMRQTFSPFGQI 241

  Fly   259 QSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQML--------FDRRMTVRLDRIPDKNEG 315
            ..:.:..||     |::.|.:.....|..||..::...:        :.:.....::.:..:|: 
  Rat   242 MEIRVFPDK-----GYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQ- 300

  Fly   316 IKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQLLGNAQQ-------GSQLGSVG--SQPN 371
            |..|...|                         ..||..|||||       |.|:.:.|  .||.
  Rat   301 IGYPPAYG-------------------------QWGQWYGNAQQIGQYVPNGWQVPAYGMYGQPW 340

  Fly   372 SSAVSNAT 379
            |....|.|
  Rat   341 SQQGFNQT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 77/398 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831 21/83 (25%)
RRM2_hnRNPM_like 234..307 CDD:240832 11/80 (14%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Tia1XP_006236890.1 ELAV_HUD_SF 6..281 CDD:273741 58/303 (19%)
RRM_SF 8..82 CDD:302621 20/74 (27%)
RRM2_TIA1 106..185 CDD:241062 15/86 (17%)
RRM3_TIAR 215..287 CDD:241064 11/76 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.