DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Cstf2t

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001101056.1 Gene:Cstf2t / 309338 RGDID:1310026 Length:629 Species:Rattus norvegicus


Alignment Length:612 Identity:124/612 - (20%)
Similarity:205/612 - (33%) Gaps:204/612 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAARDRSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFD-ESGKARGCGIVEFKDP 108
            :|.||.:.:|....|::.||||:...:.|||:|.. |||:...:|.:| |:||.:|.|..|::|.
  Rat     4 LAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSE-VGSVVSFRLVYDRETGKPKGYGFCEYQDQ 67

  Fly   109 ENVQKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGG 173
            |....|:..:|..|.:||.|                                             
  Rat    68 ETALSAMRNLNGREFSGRAL--------------------------------------------- 87

  Fly   174 RDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVAN 238
                         |.|:..|.:|.                     ..|:|||.:.|:.:..:...
  Rat    88 -------------RVDNAASEKNK---------------------EELKSLGPAAPIIDSPYGDP 118

  Fly   239 LDYK---------VDNKKLKQVFKLAGKVQSVDLSLDKEGNSR-------GFAVIEYDHPVEAVQ 287
            :|.:         |.:...:|:|:|..:::....:..:|..:.       .:|::      :|..
  Rat   119 IDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALL------QAQV 177

  Fly   288 AISMLDRQM---LFDRRMTVRLDRIPDKNEGIKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQS 349
            .:.::|.::   :..|::.| ...||.|::.:..| |.||.|...||.|          |..|.:
  Rat   178 VMRIMDPEIALKILHRKIHV-TPLIPGKSQPVSGP-GPGGPGGPGGPGG----------PGPGPA 230

  Fly   350 QGQLLG-NAQQGSQLGSVGSQPN---SSAVSNATTNLLNNLTGVMFGNHAAVQPSPV-APVQKPS 409
            .|...| |.....|  :...||.   ...|.:....:..::.|      ....|.|: |.|..|.
  Rat   231 PGLCPGPNVMLNQQ--NPAPQPQHLPRRPVKDIPPLMQTSIQG------GIPAPGPIPAAVPGPG 287

  Fly   410 LGNNTGSGGLNLNNLNPSILAAVVGNLGNQGGNLS----------NPLLSSSLSNLGLNLGNSGN 464
            .|:.|..|     .:.|.:...|||.:..:.|.:.          .|:.|..:...|| ||::.|
  Rat   288 PGSLTPGG-----TMQPQVGMPVVGPVPLERGQMQISDPRPPMPRGPMPSGGIPPRGL-LGDAPN 346

  Fly   465 DDNLPPSNVGLSNNYSSGGTGGGNSYSSGNNYSGGG-------------GSSNLGYNAYSSSGG- 515
            |..                  ||...|........|             |..|.|..::...|| 
  Rat   347 DPR------------------GGTLLSVTGEVEPRGYMGPPHQGPPMHHGHDNRGPASHDMRGGP 393

  Fly   516 -------MGGGNGGVGVDGNDYNTGNPLDVYGGGSNVGNSNVGSANAV----GASRKSDTIIIKN 569
                   :.|...|..:|    ..|.|:|..||..:.|.........|    |..|:.:      
  Rat   394 LAADPRMLIGEPRGPMMD----QRGLPMDGRGGRDSRGMEARPMETEVLEPRGMERRME------ 448

  Fly   570 VPITCTWQTLRDKFREIGDVKFAEIRG 596
               ||..:|...:.|.| |.:..|:||
  Rat   449 ---TCAMETRGMEARGI-DARGLEMRG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 83/411 (20%)
RRM1_hnRNPM_like 58..133 CDD:240831 28/75 (37%)
RRM2_hnRNPM_like 234..307 CDD:240832 11/91 (12%)
RRM <543..>631 CDD:223796 13/58 (22%)
RRM_SF 565..630 CDD:302621 9/32 (28%)
Cstf2tNP_001101056.1 RRM <16..>109 CDD:223796 36/172 (21%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 30/132 (23%)
CSTF2_hinge 113..191 CDD:291025 9/83 (11%)
CSTF_C 585..625 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.