DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and Srsf5

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:205 Identity:47/205 - (22%)
Similarity:71/205 - (34%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SREKERDRRGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNC-------RVYISNIPYDY 68
            :|.:.|..||||....||                 ::|....:|||.       |:.:.|:....
  Rat    72 ARARSRGGRGRGRYSDRF-----------------SSRRPRNDRRNAPPVRTENRLIVENLSSRV 119

  Fly    69 RWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKED 133
            .|||||| |.|..|.:    .|.|........|:|||....:::.|:||::..|:|||::.:.| 
  Rat   120 SWQDLKD-FMRQAGEV----TFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE- 178

  Fly   134 HGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRNNF 198
                                                  |.:.|...|.|..||......|...:.
  Rat   179 --------------------------------------GSKRHSRSRSRSRSRTRSSSRSRSRSR 205

  Fly   199 NMMSNDYNNS 208
            :..|..|:.|
  Rat   206 SRRSKSYSRS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 39/168 (23%)
RRM1_hnRNPM_like 58..133 CDD:240831 24/74 (32%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 0/1 (0%)
RRM2_SRSF5 99..179 CDD:410158 27/123 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.