Sequence 1: | NP_649899.1 | Gene: | rump / 41138 | FlyBaseID: | FBgn0267790 | Length: | 632 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038967784.1 | Gene: | Srsf5 / 29667 | RGDID: | 3664 | Length: | 270 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 71/205 - (34%) | Gaps: | 68/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 SREKERDRRGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRERRNC-------RVYISNIPYDY 68
Fly 69 RWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKED 133
Fly 134 HGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFSRRDDDRLSGRNNF 198
Fly 199 NMMSNDYNNS 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rump | NP_649899.1 | PABP-1234 | 48..435 | CDD:130689 | 39/168 (23%) |
RRM1_hnRNPM_like | 58..133 | CDD:240831 | 24/74 (32%) | ||
RRM2_hnRNPM_like | 234..307 | CDD:240832 | |||
RRM | <543..>631 | CDD:223796 | |||
RRM_SF | 565..630 | CDD:302621 | |||
Srsf5 | XP_038967784.1 | RRM1_SRSF5 | 5..74 | CDD:410008 | 0/1 (0%) |
RRM2_SRSF5 | 99..179 | CDD:410158 | 27/123 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |