DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and usp101

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_593779.1 Gene:usp101 / 2542461 PomBaseID:SPAC19A8.13 Length:261 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:44/160 - (27%)
Similarity:70/160 - (43%) Gaps:34/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDE-SGKARGCGIVEFKDPENVQKALEKMNRYE 122
            :::|.:.||.:..|::..|.| .|.||.:::..:: :||:.|...|.|:...:::.|.:......
pombe   102 MFLSRLSYDTKESDIEREFTR-YGPIERIRVVRNKVTGKSMGYAFVVFERERDLKVAYKASAGLM 165

  Fly   123 VNGRELVVKEDHGEQRDQYGRIVRDGGGGGGG----------------------GGGVQGGNGGN 165
            :|||.:||..:.|  |...|.:.|..|||.||                      .||.:||...:
pombe   166 LNGRRIVVDVERG--RTVKGWLPRKLGGGLGGRHYTKERPRRERGSRFRGDSGFRGGYRGGFRKS 228

  Fly   166 NGGGGGGGR-----DHMDD---RDRGFSRR 187
            :|||...||     .|..|   ||....||
pombe   229 SGGGSRFGRGPTRSSHSSDYGGRDSSPKRR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 44/160 (28%)
RRM1_hnRNPM_like 58..133 CDD:409819 20/74 (27%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
usp101NP_593779.1 U1snRNP70_N 3..91 CDD:432406
RRM_snRNP70 99..188 CDD:409682 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.