DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and cip1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_596771.1 Gene:cip1 / 2539823 PomBaseID:SPBC16A3.18 Length:490 Species:Schizosaccharomyces pombe


Alignment Length:282 Identity:65/282 - (23%)
Similarity:113/282 - (40%) Gaps:63/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 TGVMFGNHAAVQ--PSP-----VAPVQKPSLGNNTG------------SGGLNLNNLN-----PS 427
            :|....||.|:.  .||     :.|:..|.....|.            ||.|:|.:..     ||
pombe    22 SGTKKSNHEALSRLQSPLNSPKLQPIGSPQASRKTSGSGSSAPLYPKWSGALSLASSRAASPAPS 86

  Fly   428 ILAAVVGNLGNQGGNLSNPLLSSSLSNLGLNLGNSGNDDNLPPSNVGLSNNYSSGGTGGGNSYSS 492
            ......|.  :|.|.|.|       |:.|..|.||.|....|..:   |.|.:|.......::.:
pombe    87 DSFPTFGY--SQLGGLEN-------SSKGSALFNSANSIGTPYLS---SRNSNSANEASAMAFHN 139

  Fly   493 GNNYSGGGGSSNLGYNAYSSSGGMGGGNGGVGVDGNDYNT-GNP-LDVYGGGSNVGNSNVGSANA 555
            .:..||...||.  ..::|:||           .||..:| ..| ||.: ..:.:...:..::|:
pombe   140 VSPPSGAESSSE--SKSFSASG-----------KGNKADTSAEPSLDAF-NSTQIKAGSTANSNS 190

  Fly   556 VGASRKSDT----IIIKNVPITCTWQTLRDKFREIGDVK-FAEIRGNDVGVVR------FFKERD 609
            .......||    |::||:|.:....||.|.|:::|..: :|.....|.|:.|      |::..:
pombe   191 TPVEPGEDTIPTAIVVKNIPFSLEKDTLLDHFKQLGIPRPYAFNYHYDNGIFRGLAFANFYRPEE 255

  Fly   610 AELAIALMDGSRLDGRNIKVTY 631
            |::.:..::|..::||.::|.:
pombe   256 AQVVVQTLNGYEINGRRLRVEW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 15/71 (21%)
RRM1_hnRNPM_like 58..133 CDD:240831
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796 22/98 (22%)
RRM_SF 565..630 CDD:302621 18/71 (25%)
cip1NP_596771.1 RRM 94..343 CDD:223796 49/210 (23%)
RRM_PIN4_like 201..279 CDD:240699 19/77 (25%)
DUF3886 <278..310 CDD:289771 65/282 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23003
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.