Sequence 1: | NP_649899.1 | Gene: | rump / 41138 | FlyBaseID: | FBgn0267790 | Length: | 632 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033250.3 | Gene: | Snrnp70 / 20637 | MGIID: | 98341 | Length: | 448 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 51/200 - (25%) |
---|---|---|---|
Similarity: | 86/200 - (43%) | Gaps: | 32/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 ESREK--ERDRRGRGARGSRFTDAD----GNGNGAGSQGGGVAARDRSRERRNCRVYISNIPYDY 68
Fly 69 RWQDLKDLFRRIVGSIEYVQLFFDE-SGKARGCGIVEFKDPENVQKALEKMNRYEVNGRELVVKE 132
Fly 133 DHGEQRDQYG-RIVRDGGGGGG---GGGGVQGGNGGNNGGG------GGGGRDHMD-DRDRGFSR 186
Fly 187 RDDDR 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rump | NP_649899.1 | PABP-1234 | 48..435 | CDD:130689 | 39/155 (25%) |
RRM1_hnRNPM_like | 58..133 | CDD:240831 | 16/75 (21%) | ||
RRM2_hnRNPM_like | 234..307 | CDD:240832 | |||
RRM | <543..>631 | CDD:223796 | |||
RRM_SF | 565..630 | CDD:302621 | |||
Snrnp70 | NP_033250.3 | U1snRNP70_N | 3..93 | CDD:371969 | 8/31 (26%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..79 | 8/17 (47%) | |||
Required for interaction with U1 RNA. /evidence=ECO:0000250|UniProtKB:P08621 | 92..202 | 29/123 (24%) | |||
RRM_snRNP70 | 102..187 | CDD:240682 | 18/98 (18%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 187..439 | 20/59 (34%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |