DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and rsp-6

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_741446.1 Gene:rsp-6 / 177566 WormBaseID:WBGene00004703 Length:179 Species:Caenorhabditis elegans


Alignment Length:151 Identity:48/151 - (31%)
Similarity:70/151 - (46%) Gaps:28/151 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNR 120
            :.:||:..:|.|...|:|:::|.|. |.|..|.:    :.:..|...||:.|..:.:.|:..::.
 Worm     2 DAKVYVGGLPSDATSQELEEIFDRF-GRIRKVWV----ARRPPGFAFVEYDDVRDAEDAVRALDG 61

  Fly   121 YEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDR-DRGF 184
            ..:.|....|:...|::|           ||||.|||.        ||.||||||....| |||.
 Worm    62 SRICGVRARVELSTGQRR-----------GGGGRGGGF--------GGRGGGGRDRSPYRGDRGR 107

  Fly   185 SR-RDDDRLSGRNNFNMMSND 204
            || |..||  ||:.....|.|
 Worm   108 SRSRSRDR--GRDRSRDRSRD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 48/151 (32%)
RRM1_hnRNPM_like 58..133 CDD:409819 18/74 (24%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
rsp-6NP_741446.1 RRM_SRSF3_like 4..75 CDD:409808 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.