DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and rsp-1

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_496442.1 Gene:rsp-1 / 174748 WormBaseID:WBGene00004698 Length:312 Species:Caenorhabditis elegans


Alignment Length:260 Identity:68/260 - (26%)
Similarity:101/260 - (38%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKMNRYE 122
            |:||..:......:|::..||. .|.|..|.|       ..|.|.|||.|..:.:.|:..:|..|
 Worm     4 RIYIGRLTSRVSEKDIEHFFRG-YGQIRDVLL-------KNGFGFVEFDDKRDAEDAVHDLNGKE 60

  Fly   123 VNGRELVVKEDHGEQRDQYGRIVRDGGG--GGGGGGGVQGGNGGNNGGGGGGGRDHMDDRDRGFS 185
            :.|..:::  |:.:.        |.|||  ||.||||..|....:..||||||||..|..|||..
 Worm    61 LGGERVIL--DYSKP--------RGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPP 115

  Fly   186 RRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQ 250
            ||:                       :.||...|          ..::|.|.||..::..:.||.
 Worm   116 RRE-----------------------SRYGRPYS----------TRHRVVVENLSSRISWQDLKD 147

  Fly   251 VFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG 315
            ..:..| |:.......|..|.   |::.:..|.:..:.|...|...|..|::.:    |.|...|
 Worm   148 QVRRQG-VEPTYAEAHKRPNE---ALLCFATPSDLKRCIEKCDGMDLNGRKIKM----IDDSQAG 204

  Fly   316  315
             Worm   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 68/260 (26%)
RRM1_hnRNPM_like 58..133 CDD:240831 20/74 (27%)
RRM2_hnRNPM_like 234..307 CDD:240832 16/72 (22%)
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
rsp-1NP_496442.1 RRM <3..180 CDD:223796 61/230 (27%)
RRM1_SRSF4_like 4..73 CDD:240783 21/78 (27%)
RRM2_SRSF4_like 129..200 CDD:241044 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.