DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and CSTF2

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens


Alignment Length:520 Identity:94/520 - (18%)
Similarity:153/520 - (29%) Gaps:211/520 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GVAARDRSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFD-ESGKARGCGIVEFKD 107
            |:..||.:.:|....|::.||||:...:.|||:|.. ||.:...:|.:| |:||.:|.|..|::|
Human     3 GLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSE-VGPVVSFRLVYDRETGKPKGYGFCEYQD 66

  Fly   108 PENVQKALEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGG 172
            .|....|:..:|..|.:||.|                                            
Human    67 QETALSAMRNLNGREFSGRAL-------------------------------------------- 87

  Fly   173 GRDHMDDRDRGFSRRDDDRLSGRNNFNMMSNDYNNSSNYNLYGLSASFLESLGISGPLHNKVFVA 237
                          |.|:..|.:|.                     ..|:|||...|:....:  
Human    88 --------------RVDNAASEKNK---------------------EELKSLGTGAPVIESPY-- 115

  Fly   238 NLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRM 302
                                               |..:...|.|....:|::.|..:.:|:...
Human   116 -----------------------------------GETISPEDAPESISKAVASLPPEQMFELMK 145

  Fly   303 TVRLDRIPDKNEGIKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQLLGNAQQGSQLGSVG 367
            .::|                                ...|.|.  :::..||.|.|....|  :.
Human   146 QMKL--------------------------------CVQNSPQ--EARNMLLQNPQLAYAL--LQ 174

  Fly   368 SQPNSSAVS-NATTNLLNNLTGVMFGNHAAVQPSPVAPVQKPSLGNNTGSG-GLNLNNLNPSILA 430
            :|.....|. .....:|:..|.:         |:.:|...:|..|...||| .:::|..||.  |
Human   175 AQVVMRIVDPEIALKILHRQTNI---------PTLIAGNPQPVHGAGPGSGSNVSMNQQNPQ--A 228

  Fly   431 AVVGNLGNQGGNLSNPLLSSSLSNLGLNLGNSGNDDNLPPSNVGLSNNYSSGGTGGGNSYSSGNN 495
            ....:||....|.:.||:.:|:.      |.......:|.:..|                     
Human   229 PQAQSLGGMHVNGAPPLMQASMQ------GGVPAPGQMPAAVTG--------------------- 266

  Fly   496 YSGGGGSSNLGYNAYSSSGGMGGGNGGVGVDGNDYNTGNPLDVYGGGSNVGNSNVGSANAVGASR 560
              .|.||...|          ||....||:.|:     .|:.:..|...:.:|.||.|......|
Human   267 --PGPGSLAPG----------GGMQAQVGMPGS-----GPVSMERGQGTLQHSPVGPAGPASIER 314

  Fly   561  560
            Human   315  314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 68/389 (17%)
RRM1_hnRNPM_like 58..133 CDD:240831 27/75 (36%)
RRM2_hnRNPM_like 234..307 CDD:240832 6/72 (8%)
RRM <543..>631 CDD:223796 5/18 (28%)
RRM_SF 565..630 CDD:302621
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 93/519 (18%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 29/132 (22%)
CSTF2_hinge 112..191 CDD:373015 16/151 (11%)
PRK14718 <412..>469 CDD:173181
CSTF_C 553..593 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.