DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and x16

DIOPT Version :10

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_061512248.1 Gene:x16 / 1277682 VectorBaseID:AGAMI1_014998 Length:231 Species:Anopheles gambiae


Alignment Length:150 Identity:46/150 - (30%)
Similarity:66/150 - (44%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKAL 115
            ||...:.:||:..:..:...||:::.| ...|.:..|.:..:..|.|    .|||:|..:.:.|:
Mosquito     5 SRYPHDAKVYVGELGNNASKQDIEEAF-GYYGPLRNVWVARNPPGFA----FVEFEDARDAEDAV 64

  Fly   116 EKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDDR 180
            ..::...::||.              .|:....|.||.|||   ||.||...|||.|||...|||
Mosquito    65 RGLDGRTISGRR--------------ARVELSTGRGGRGGG---GGRGGPPRGGGKGGRFQSDDR 112

  Fly   181 -----DRGFSRRDDDRLSGR 195
                 .||...||..| |||
Mosquito   113 CYECGGRGHFARDCAR-SGR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 45/149 (30%)
RRM1_hnRNPM_like 58..133 CDD:409819 16/74 (22%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
x16XP_061512248.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.