DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rump and srsf4

DIOPT Version :9

Sequence 1:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_004911639.2 Gene:srsf4 / 100038227 XenbaseID:XB-GENE-493077 Length:741 Species:Xenopus tropicalis


Alignment Length:214 Identity:54/214 - (25%)
Similarity:83/214 - (38%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMDASNSV----------------ESREKERD-RRGRGARGSRFTDADGNGNGAGSQGGGVAARD 49
            |.||.::|                .:|...|| |.|.|.|            ..||...|...|.
 Frog    50 SRDAEDAVYEMNGRELCGERVIVEHARAPRRDIRSGYGYR------------KGGSDKYGPPVRT 102

  Fly    50 RSRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKA 114
            ..|.|      :.|:.....|||||| |.|..|.:.|.    |...:.:..|::||:...::::|
 Frog   103 MYRLR------VENLSSRCSWQDLKD-FMRQAGEVTYA----DAHQRRQNEGVIEFRSYSDMRRA 156

  Fly   115 LEKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMDD 179
            |||::..|:|||::.:.||....|::       |.............:..::.......|.|...
 Frog   157 LEKLDGSEINGRKIQLVEDRAGSRNK-------GSSSRSRSRSRSRRSRSSHSRSRSRSRSHSRS 214

  Fly   180 RDRGFSR-RDDDRLSGRNN 197
            |.|..|| |..:|.|.|::
 Frog   215 RQRERSRSRSKERRSSRSH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 40/151 (26%)
RRM1_hnRNPM_like 58..133 CDD:240831 23/74 (31%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
srsf4XP_004911639.2 RRM_SF 6..77 CDD:418427 4/26 (15%)
RRM_SF 104..176 CDD:418427 26/82 (32%)
ser_rich_anae_1 <249..>456 CDD:411418
PRK12678 352..>573 CDD:237171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.