DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8149 and MOS11

DIOPT Version :9

Sequence 1:NP_649898.1 Gene:CG8149 / 41137 FlyBaseID:FBgn0037700 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_195897.1 Gene:MOS11 / 831253 AraportID:AT5G02770 Length:214 Species:Arabidopsis thaliana


Alignment Length:237 Identity:59/237 - (24%)
Similarity:83/237 - (35%) Gaps:97/237 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NSQQSTGTVASTGTTPSKENEAPAAAASDSTGETPTK----------KHKPI----VVGPKTEGE 171
            |.::.|.||.:.|..              ||||.|.|          :...|    |.|....||
plant     4 NGEKVTATVVNGGGL--------------STGENPKKIVDLNTTELDRTDDILDGEVKGFSDSGE 54

  Fly   172 K---------------PSGD--------KKLN---------QLTAQERLELRAKKFGITPPAVAN 204
            |               .|||        ||:.         :||.:|:...||::||....||.|
plant    55 KKEETDSNGIGSTAGVDSGDISPVDDIQKKIRRAERFGVSVKLTEEEKRNSRAERFGTVAAAVVN 119

  Fly   205 TATAVAVAINKSSSASITANKGNKETEEQQKEALKKRAERFGFVVPD-KAPTSKADDRLQK--RK 266
                              .::|.|:.||.:::|   ||:|||  ||. .:.|.|.::..:|  |.
plant   120 ------------------GSEGTKKAEELKRKA---RADRFG--VPSATSTTDKTEEEAKKKARL 161

  Fly   267 ERFGAGAVSAATTTPTTTESKDAWSEKARARLERFKTAPSTN 308
            .|||           ..|:...|...|.:||..||....|.:
plant   162 ARFG-----------KETKVDSAEENKRKARALRFSKEASAD 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8149NP_649898.1 SAP 6..40 CDD:280251
MOS11NP_195897.1 PTZ00121 <45..>213 CDD:173412 47/182 (26%)
Tho1_MOS11_C 78..111 CDD:408375 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103733
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.