DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8149 and sarnp

DIOPT Version :9

Sequence 1:NP_649898.1 Gene:CG8149 / 41137 FlyBaseID:FBgn0037700 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_012812427.1 Gene:sarnp / 549238 XenbaseID:XB-GENE-5835037 Length:215 Species:Xenopus tropicalis


Alignment Length:299 Identity:77/299 - (25%)
Similarity:120/299 - (40%) Gaps:94/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DVTKMKVADLKRELKLRGLAVNGNKTELQDRLQTALLEGDLSLEDSAIADAIDDDDVSFTDEDEH 69
            ::.|:|:|:||:|...|||.|.|||::|..|||.       .:|:....:.:.:.:....:||  
 Frog     6 ELHKLKLAELKQECLARGLEVKGNKSDLISRLQA-------YIEEHGSEELLLNSEEEANEED-- 61

  Fly    70 KLLGDENDDELLKSPVSTPTTVAIPDLLAEEKTSSAPDAAAPTKKIVLKRNNSQQSTGTVASTGT 134
             :||:|.::|..||.|:.         :.||:....|......||:|                  
 Frog    62 -VLGEETEEEEQKSSVAA---------VKEEEPDDKPADTNAEKKLV------------------ 98

  Fly   135 TPSKENEAPAAAASDSTGETPTKKHKPIVVGPKTEGEKPSGDKKLNQLTAQERLELRAKKFGITP 199
                       ..|.|..||                               ::|:.||::|.: |
 Frog    99 -----------KISSSASET-------------------------------DKLQKRAERFNV-P 120

  Fly   200 PAVANTATAVAVAINKSSSASITANKGNKETEEQ--QKEALKKRAERFGFVVPDKAPTSKADDRL 262
            .:|.:...|.|:....|:|    ..||.....:.  ..:.||:||:|||..|...:..|:.|::|
 Frog   121 ASVDSKKAARAIRFGLSTS----DKKGEISDAKSPVSMDKLKERAQRFGLSVSPVSKKSEDDEKL 181

  Fly   263 QKRKERFGAGAVSAATTTPTTTESKDAWSEKARARLERF 301
            :|||||||....||:.|..|        ..|.|.|.|||
 Frog   182 KKRKERFGIVTSSASVTDDT--------EAKKRKRAERF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8149NP_649898.1 SAP 6..40 CDD:280251 17/33 (52%)
sarnpXP_012812427.1 SAP 7..41 CDD:128789 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1120366at2759
OrthoFinder 1 1.000 - - FOG0005604
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.