Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229288.1 | Gene: | RHOBTB1 / 9886 | HGNCID: | 18738 | Length: | 696 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 62/201 - (30%) |
---|---|---|---|
Similarity: | 101/201 - (50%) | Gaps: | 39/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 RP----LKITIVGDGMVGKTCML------ITYTRNEFPEEYIPTVF--DNH-AC-------NIAV 78
Fly 79 DDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVV 143
Fly 144 LVGTKLDLRIPNSE----------------KFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVF 192
Fly 193 EEAVRA 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 58/193 (30%) |
RHO | 38..202 | CDD:197554 | 59/193 (31%) | ||
RHOBTB1 | NP_001229288.1 | Rho-like | 1..210 | 62/201 (31%) | |
RhoBTB | 13..207 | CDD:133275 | 60/197 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 327..348 | ||||
BTB | <396..455 | CDD:197585 | |||
BTB | 476..581 | CDD:306997 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |