DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHOBTB1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001229288.1 Gene:RHOBTB1 / 9886 HGNCID:18738 Length:696 Species:Homo sapiens


Alignment Length:201 Identity:62/201 - (30%)
Similarity:101/201 - (50%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RP----LKITIVGDGMVGKTCML------ITYTRNEFPEEYIPTVF--DNH-AC-------NIAV 78
            ||    :|..:|||..||||.::      .|.|:.:....::|||:  |.: .|       ...|
Human     9 RPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVV 73

  Fly    79 DDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVV 143
            |:...:|.||||.|  |:.:.|..:|..::..:||:||::..|..:|||.|:|||:||....||:
Human    74 DEVSVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVI 136

  Fly   144 LVGTKLDLRIPNSE----------------KFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVF 192
            |||.:||||..:.|                ..:..::|:::.||: .....|.|...:..::.||
Human   137 LVGCQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKEL-GLPYYETSVFDQFGIKDVF 200

  Fly   193 EEAVRA 198
            :.|:||
Human   201 DNAIRA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 58/193 (30%)
RHO 38..202 CDD:197554 59/193 (31%)
RHOBTB1NP_001229288.1 Rho-like 1..210 62/201 (31%)
RhoBTB 13..207 CDD:133275 60/197 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..348
BTB <396..455 CDD:197585
BTB 476..581 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.