DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHO3

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_012148.1 Gene:RHO3 / 854688 SGDID:S000001380 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:87/225 - (38%)
Similarity:118/225 - (52%) Gaps:36/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDT 90
            :|:.:..|...||.|:|||..|||.:|..:||..|||.|.||||:|:..:|.||.:...|:||||
Yeast     7 SASTSNKPIERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDT 71

  Fly    91 AGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR--- 152
            ||||:::|||.|||..|.|.:||:||.||.|.|||::||..||......|.:|||..|.|||   
Yeast    72 AGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNE 136

  Fly   153 ---------------------------IPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQ 190
                                       ..|.:..::.:||..|.|:|.|...:|||||..:.:.:
Yeast   137 NESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNE 201

  Fly   191 VFEEAVRA------VERKPKTTSKQSCKIL 214
            .|.||.|.      |..:.|:.|..||.|:
Yeast   202 AFTEAARVALTAGPVATEVKSDSGSSCTIM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 78/191 (41%)
RHO 38..202 CDD:197554 79/199 (40%)
RHO3NP_012148.1 Rho3 17..231 CDD:206706 84/213 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.