DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhoq

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_038934034.1 Gene:Rhoq / 85428 RGDID:621626 Length:355 Species:Rattus norvegicus


Alignment Length:138 Identity:64/138 - (46%)
Similarity:97/138 - (70%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRPLSYPSTNCF 110
            |.:.|.: :|..:.|||||:|||||::|.::.|..:.|...|:||||||||:||||||||.|:.|
  Rat   210 VRRACFM-SYANDAFPEEYVPTVFDHYAVSVTVGGKQYLFGLYDTAGQEDYDRLRPLSYPMTDVF 273

  Fly   111 LLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR-IPNS--------EKFVTTQEGK 166
            |:|:|:.:..||:|||.:|.||::.::.:||.:|:||::||| .|.:        ||.|..::|:
  Rat   274 LICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPVCVEQGQ 338

  Fly   167 KMRKEIHA 174
            |:.|||.|
  Rat   339 KLAKEIGA 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 64/138 (46%)
RHO 38..202 CDD:197554 64/138 (46%)
RhoqXP_038934034.1 P-loop_NTPase 210..350 CDD:422963 64/138 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.