DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and GEM1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_009351.1 Gene:GEM1 / 851249 SGDID:S000000046 Length:662 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:50/194 - (25%)
Similarity:84/194 - (43%) Gaps:46/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDY---------NLTLWDTA 91
            :::.|.||..|||:.::::.|:.||    |||:.| ....|:: .||:         |..|.||:
Yeast     6 IRVVICGDEGVGKSSLIVSLTKAEF----IPTIQD-VLPPISI-PRDFSSSPTYSPKNTVLIDTS 64

  Fly    92 GQE----DYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLD-- 150
            ..:    |:|      ..|.:...|.|  ....|:::|...|.|..|....::||:|...|.|  
Yeast    65 DSDLIALDHE------LKSADVIWLVY--CDHESYDHVSLFWLPHFRSLGLNIPVILCKNKCDSI 121

  Fly   151 --------LRIPNSEKFVTTQ-EGKKM------RKEIHAFNLVECSAKKKQNLQQVFEEAVRAV 199
                    :...||:..:.|: |.::.      .|||.  ..::.|||.:.:|.|.|....||:
Yeast   122 SNVNANAMVVSENSDDDIDTKVEDEEFIPILMEFKEID--TCIKTSAKTQFDLNQAFYLCQRAI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 48/191 (25%)
RHO 38..202 CDD:197554 50/192 (26%)
GEM1NP_009351.1 P-loop_NTPase 6..186 CDD:422963 50/194 (26%)
EF_assoc_2 236..329 CDD:400591
EF_assoc_1 369..434 CDD:400590
Miro2 445..624 CDD:206679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.