DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RAC10

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_201093.1 Gene:RAC10 / 836408 AraportID:AT5G62880 Length:215 Species:Arabidopsis thaliana


Alignment Length:192 Identity:98/192 - (51%)
Similarity:129/192 - (67%) Gaps:18/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            :|...||||.||||||||.||.|:||.:||||||||.:.|:.|:....||.||||||||||.|||
plant     9 IKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLR 73

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSEKF------ 159
            ||||...:.|:|.:|:.||.|:|||..||.||::||:..||:||||||||||   .:|.      
plant    74 PLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLR---EDKHYLADHP 135

  Fly   160 ----VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVR-----AVERKPKTTSKQSCK 212
                |||.:|:::||.|.|...:|||:|.:||::.||:.|::     .|::|.||..|:..|
plant   136 GLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 92/176 (52%)
RHO 38..202 CDD:197554 92/178 (52%)
RAC10NP_201093.1 Rop_like 8..180 CDD:206705 92/173 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.