DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rnd3a

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_955816.1 Gene:rnd3a / 80963 ZFINID:ZDB-GENE-010319-40 Length:243 Species:Danio rerio


Alignment Length:199 Identity:68/199 - (34%)
Similarity:110/199 - (55%) Gaps:14/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KPGMTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLT 86
            :|||..:   .....||.:|||...|||.:|..:.::.|||.|:||||:|:..:..:|.:...|:
Zfish    13 QPGMDPS---QSLKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDKQRIELS 74

  Fly    87 LWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDL 151
            ||||:|...|:.:||||||.::..::|:.||...:.::|..||..||:.|..:..::|||.|.||
Zfish    75 LWDTSGSPYYDNVRPLSYPDSDAVIICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDL 139

  Fly   152 R--------IPNSEKF-VTTQEGKKMRKEIHAFNLVECSAKKKQN-LQQVFEEAVRAVERKPKTT 206
            |        :.|..:. |:..:|..|.|:|.| ..:||||.:.:| ::.:|..|..|...|....
Zfish   140 RTDLTTLVELSNHRQTPVSYDQGSAMAKQISA-PYIECSAVQSENSVRDIFHVATLACVNKNNKN 203

  Fly   207 SKQS 210
            .|::
Zfish   204 IKRN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 62/171 (36%)
RHO 38..202 CDD:197554 62/173 (36%)
rnd3aNP_955816.1 Rnd3_RhoE_Rho8 19..197 CDD:206735 63/181 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.