DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and zgc:153713

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001038815.1 Gene:zgc:153713 / 751630 ZFINID:ZDB-GENE-060825-41 Length:193 Species:Danio rerio


Alignment Length:185 Identity:93/185 - (50%)
Similarity:123/185 - (66%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
            |:.|||||..||||:||.:::::|||.|:||||:|:..:|.||.:...|.||||||||||:||||
Zfish     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRP 71

  Fly   102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSE--------- 157
            ||||.|:..|:|:||.|..|.||:..||.||::||..:||::|||.|.|||  |.|         
Zfish    72 LSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLR--NDEHTRRELFKM 134

  Fly   158 --KFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAV--ERKPKTTSK 208
              :.|..:||:.|...|.||..:|||||.|..:::|||.|.||.  .||.|.:||
Zfish   135 KQEPVKPEEGRDMANRICAFGYMECSAKSKDGVREVFEMATRAALQARKGKKSSK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 86/171 (50%)
RHO 38..202 CDD:197554 87/176 (49%)
zgc:153713NP_001038815.1 RhoA_like 5..179 CDD:206662 88/173 (51%)
RHO 8..181 CDD:197554 87/174 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.