DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rnd3

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_083086.1 Gene:Rnd3 / 74194 MGIID:1921444 Length:244 Species:Mus musculus


Alignment Length:184 Identity:66/184 - (35%)
Similarity:104/184 - (56%) Gaps:10/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
            ||.:|||...|||.:|..:.::.|||.|:||||:|:..:..:|.:...|:||||:|...|:.:||
Mouse    25 KIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRP 89

  Fly   102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNS---------E 157
            ||||.::..|:|:.||...:.::|..||..||:.|..:..::|||.|.|||...|         :
Mouse    90 LSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQ 154

  Fly   158 KFVTTQEGKKMRKEIHAFNLVECSAKKKQN-LQQVFEEAVRAVERKPKTTSKQS 210
            ..|:..:|..|.|:|.|...:||||.:.:| ::.:|..|..|...|.....|::
Mouse   155 TPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 63/170 (37%)
RHO 38..202 CDD:197554 63/173 (36%)
Rnd3NP_083086.1 Rnd3_RhoE_Rho8 19..200 CDD:206735 64/174 (37%)
Effector region. /evidence=ECO:0000255 52..60 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.