DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhof

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_001073389.2 Gene:Rhof / 690130 RGDID:1584038 Length:211 Species:Rattus norvegicus


Alignment Length:206 Identity:78/206 - (37%)
Similarity:126/206 - (61%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGMTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTL 87
            |...|..:.:.:.|||.|||||..|||.:|:.|.:..|||.|.|:||:.:..::.|.:::..|.|
  Rat     7 PAPAAAPSSARKELKIVIVGDGGCGKTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNL 71

  Fly    88 WDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 152
            :||||||||:|||||||.:|:..|:||.:.:.||::||..||:||:.||...:|:||:|.|.|||
  Rat    72 YDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLR 136

  Fly   153 IPNSEKF----------VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVR----AVERKP 203
             .:.|:.          :|..:|....:::.....:|||||.::|::.||.||.:    |:::..
  Rat   137 -KDKEQLRKLRAAQLEPITYTQGLSACEQMRGALYLECSAKFRENVEDVFREATKVALSALKKAQ 200

  Fly   204 KTTSKQSCKIL 214
            :...::.|.:|
  Rat   201 RQKKQRICLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 73/175 (42%)
RHO 38..202 CDD:197554 72/177 (41%)
RhofXP_001073389.2 Rho4_like 17..211 CDD:206704 75/194 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.