DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhot1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_006533949.1 Gene:Rhot1 / 59040 MGIID:1926078 Length:752 Species:Mus musculus


Alignment Length:170 Identity:45/170 - (26%)
Similarity:87/170 - (51%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFD-NHACNIAVDDRDYNLTLWDTAGQEDYE 97
            :.::|.:||:..||||.::::....|||||..|...: ....::..:....::..:..|.|.|.:
Mouse    16 KDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQ 80

  Fly    98 RLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFS---AHVPVVLVGTKLDLRIPNSEKF 159
            ..:.:|..:..|  :.|:::::.|.:.|.|:|.|.|...:   :.:|::|||.|.||...:|.:.
Mouse    81 LHQEISQANVIC--IVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMET 143

  Fly   160 VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAV 199
            :.    ..|.:.......||||||..:|:.::|..|.:||
Mouse   144 IL----PIMNQYTEIETCVECSAKNLKNISELFYYAQKAV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 43/165 (26%)
RHO 38..202 CDD:197554 45/166 (27%)
Rhot1XP_006533949.1 Miro1 16..182 CDD:206680 45/170 (26%)
EF_assoc_2 232..316 CDD:369829
EF_assoc_1 354..423 CDD:369828
Miro2 428..593 CDD:206679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.