Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061485.1 | Gene: | RAC1 / 5879 | HGNCID: | 9801 | Length: | 211 | Species: | Homo sapiens |
Alignment Length: | 208 | Identity: | 101/208 - (48%) |
---|---|---|---|
Similarity: | 131/208 - (62%) | Gaps: | 29/208 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
Fly 101 PLSYPST-------------------NCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVG 146
Fly 147 TKLDLRIPNS--EKF-------VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERK 202
Fly 203 PKTTS-KQSCKIL 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 94/189 (50%) |
RHO | 38..202 | CDD:197554 | 96/191 (50%) | ||
RAC1 | NP_061485.1 | Rac1_like | 3..195 | CDD:206663 | 95/190 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24072 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |