Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067028.1 | Gene: | RHOU / 58480 | HGNCID: | 17794 | Length: | 258 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 84/207 - (40%) |
---|---|---|---|
Similarity: | 125/207 - (60%) | Gaps: | 21/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 RGKKPGMTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDY 83
Fly 84 NLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTK 148
Fly 149 LDLR---------IPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRA------ 198
Fly 199 VERKPKTTSKQS 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 77/170 (45%) |
RHO | 38..202 | CDD:197554 | 77/178 (43%) | ||
RHOU | NP_067028.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | 2/5 (40%) | |
Wrch_1 | 50..222 | CDD:133330 | 77/171 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |