DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rhobtb3

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_691270.6 Gene:rhobtb3 / 562804 ZFINID:ZDB-GENE-091204-190 Length:619 Species:Danio rerio


Alignment Length:100 Identity:23/100 - (23%)
Similarity:47/100 - (47%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 WDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAH--VPVVL--VGTK 148
            ||.. ..|:..:|.: ....:..::.||::.:.:|:.|::.:.|.:|....|  |||:|  ||.:
Zfish    81 WDIL-DSDWVSVRSI-LEQADIVVIKYSVNDKLAFQQVRNGYAPRLRPLLRHWGVPVILVAVGAR 143

  Fly   149 LD---------LRIPNSEKFVTTQEGKKMRKEIHA 174
            |:         |...:....|...||.::.:::.|
Zfish   144 LNDEGPPCTCPLCASDWSSCVPHSEGLQLSRDLGA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 22/99 (22%)
RHO 38..202 CDD:197554 22/99 (22%)
rhobtb3XP_691270.6 P-loop_NTPase <97..189 CDD:304359 18/81 (22%)
BTB 254..>296 CDD:295341
BTB 417..518 CDD:279045
BTB 428..518 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.