DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHOT1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001028740.1 Gene:RHOT1 / 55288 HGNCID:21168 Length:691 Species:Homo sapiens


Alignment Length:170 Identity:45/170 - (26%)
Similarity:87/170 - (51%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFD-NHACNIAVDDRDYNLTLWDTAGQEDYE 97
            :.::|.:||:..||||.::::....|||||..|...: ....::..:....::..:..|.|.|.:
Human     3 KDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQ 67

  Fly    98 RLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFS---AHVPVVLVGTKLDLRIPNSEKF 159
            ..:.:|..:..|  :.|:::::.|.:.|.|:|.|.|...:   :.:|::|||.|.||...:|.:.
Human    68 LHQEISQANVIC--IVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMET 130

  Fly   160 VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAV 199
            :.    ..|.:.......||||||..:|:.::|..|.:||
Human   131 IL----PIMNQYTEIETCVECSAKNLKNISELFYYAQKAV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 43/165 (26%)
RHO 38..202 CDD:197554 45/166 (27%)
RHOT1NP_001028740.1 Miro1 3..169 CDD:206680 45/170 (26%)
RHO 7..169 CDD:197554 45/166 (27%)
EF_assoc_2 221..301 CDD:285547
EF_assoc_1 341..409 CDD:285546
Miro2 415..580 CDD:206679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.