Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017784.2 | Gene: | rhoub / 550481 | ZFINID: | ZDB-GENE-050417-308 | Length: | 237 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 72/207 - (34%) |
---|---|---|---|
Similarity: | 119/207 - (57%) | Gaps: | 16/207 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PGMTANITKSP-------RPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDD 80
Fly 81 RDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLV 145
Fly 146 GTKLDLR---------IPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVER 201
Fly 202 KPKTTSKQSCKI 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 66/170 (39%) |
RHO | 38..202 | CDD:197554 | 64/172 (37%) | ||
rhoub | NP_001017784.2 | Wrch_1 | 29..198 | CDD:133330 | 65/168 (39%) |
RHO | 31..202 | CDD:197554 | 64/170 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |