DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHOF

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_061907.2 Gene:RHOF / 54509 HGNCID:15703 Length:211 Species:Homo sapiens


Alignment Length:210 Identity:84/210 - (40%)
Similarity:129/210 - (61%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGMTANITKSPRP----LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDY 83
            ||..|. |.:|.|    |||.|||||..|||.:|:.|::..|||.|.|:||:.:..::.|..::.
Human     4 PGALAQ-TAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEV 67

  Fly    84 NLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTK 148
            .|.|:||||||||:|||||||.:|:..|:||.:.:.||::||..||:||:.||...:|:||:|.|
Human    68 TLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCK 132

  Fly   149 LDLRIPNSEKF----------VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVR----AV 199
            .||| .:.|:.          :|..:|....::|.|...:|||||.::|::.||.||.:    |:
Human   133 TDLR-KDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSAL 196

  Fly   200 ERKPKTTSKQSCKIL 214
            ::..:...::.|.:|
Human   197 KKAQRQKKRRLCLLL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 75/175 (43%)
RHO 38..202 CDD:197554 74/177 (42%)
RHOFNP_061907.2 Rho4_like 17..211 CDD:206704 77/194 (40%)
RHO 22..195 CDD:197554 73/173 (42%)
Effector region. /evidence=ECO:0000255 48..56 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.