DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rhoua

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001007444.1 Gene:rhoua / 492802 ZFINID:ZDB-GENE-040618-3 Length:254 Species:Danio rerio


Alignment Length:178 Identity:77/178 - (43%)
Similarity:115/178 - (64%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQE 94
            |.:.|.:|..:||||.||||.::::||.|.:|.||:||.|||.|..:|||.:...|.|.|||||:
Zfish    41 TAAERRVKCVLVGDGAVGKTSLIVSYTTNGYPTEYVPTAFDNFAAVVAVDGKPVKLQLCDTAGQD 105

  Fly    95 DYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR------- 152
            ::::||||.|.:.:.||||:|:.|.:||:||:.||.||||......|::||||:.|||       
Zfish   106 EFDKLRPLCYTNADVFLLCFSVVSPSSFQNVREKWVPEIRRHCPRAPILLVGTQSDLREDVKVLI 170

  Fly   153 --IPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRA 198
              ....|:.|..|:.....:|:.|.:.:||||..::||::||:.|:.|
Zfish   171 QLAQYKERPVEPQDASVCAEEVQAVSYMECSALTQKNLKEVFDTAIVA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 74/170 (44%)
RHO 38..202 CDD:197554 74/170 (44%)
rhouaNP_001007444.1 Wrch_1 47..219 CDD:133330 75/172 (44%)
RHO 49..221 CDD:197554 74/170 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.