DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rac1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001004840.1 Gene:rac1 / 448118 XenbaseID:XB-GENE-489008 Length:192 Species:Xenopus tropicalis


Alignment Length:189 Identity:101/189 - (53%)
Similarity:131/189 - (69%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            :|..:||||.|||||:||:||.|.||.|||||||||::.|:.||.:..||.||||||||||:|||
 Frog     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLR 68

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNS--EKF---- 159
            |||||.|:.||:|:|:.|..|||||::||:||:||...:.|::|||||||||....  ||.    
 Frog    69 PLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKK 133

  Fly   160 ---VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTS-KQSCKIL 214
               :|..:|..|.|||.|...:||||..::.|:.||:||:|||...|.... |:.|.:|
 Frog   134 LTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 94/170 (55%)
RHO 38..202 CDD:197554 96/172 (56%)
rac1NP_001004840.1 Rac1_like 3..176 CDD:206663 95/171 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.