DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rnd3b

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001002591.1 Gene:rnd3b / 436864 ZFINID:ZDB-GENE-040718-331 Length:223 Species:Danio rerio


Alignment Length:202 Identity:72/202 - (35%)
Similarity:103/202 - (50%) Gaps:32/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
            ||.:|||...|||.:|..:.::.|||.|:||||:|:..:..||.....|:||||:|...|:.:||
Zfish    10 KIVVVGDTQCGKTSLLNVFAKDSFPENYVPTVFENYTASFEVDTLRVELSLWDTSGSPYYDNVRP 74

  Fly   102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR------------IP 154
            ||||..:..|:|:.|....:.|||..||..||..|..:..::|||.|.|||            ||
Zfish    75 LSYPDADAVLICFDIGRPETLENVLRKWKGEIEEFCPNTKILLVGCKSDLRADLATFVQLSNDIP 139

  Fly   155 NSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQN-LQQVFEEAVRAV-------------ERKPKT 205
            :|     ..:|..|.|.|.| ..:||||::.:| ::.:|..|..|.             .|..|.
Zfish   140 SS-----YDQGSNMAKLISA-PYIECSAQQSENSVRDIFHIATLACVSKNNKSVKRIKSSRATKR 198

  Fly   206 TSKQSCK 212
            ||:.|.:
Zfish   199 TSRVSSR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 66/173 (38%)
RHO 38..202 CDD:197554 66/189 (35%)
rnd3bNP_001002591.1 P-loop_NTPase 4..182 CDD:304359 67/177 (38%)
RHO 11..182 CDD:197554 66/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.