Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002591.1 | Gene: | rnd3b / 436864 | ZFINID: | ZDB-GENE-040718-331 | Length: | 223 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 72/202 - (35%) |
---|---|---|---|
Similarity: | 103/202 - (50%) | Gaps: | 32/202 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
Fly 102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR------------IP 154
Fly 155 NSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQN-LQQVFEEAVRAV-------------ERKPKT 205
Fly 206 TSKQSCK 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 66/173 (38%) |
RHO | 38..202 | CDD:197554 | 66/189 (35%) | ||
rnd3b | NP_001002591.1 | P-loop_NTPase | 4..182 | CDD:304359 | 67/177 (38%) |
RHO | 11..182 | CDD:197554 | 66/176 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |