Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262895.1 | Gene: | Miro / 42845 | FlyBaseID: | FBgn0039140 | Length: | 673 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 47/197 - (23%) |
---|---|---|---|
Similarity: | 79/197 - (40%) | Gaps: | 32/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 TANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDT 90
Fly 91 AGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIR--------------------- 134
Fly 135 -HFSAHVPVVLVGTKLDL-RIPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVR 197
Fly 198 AV 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 42/184 (23%) |
RHO | 38..202 | CDD:197554 | 44/185 (24%) | ||
Miro | NP_001262895.1 | Miro1 | 10..195 | CDD:206680 | 45/192 (23%) |
RHO | 14..195 | CDD:197554 | 44/185 (24%) | ||
EF_assoc_2 | 247..328 | CDD:285547 | |||
EF_assoc_1 | 367..437 | CDD:285546 | |||
Miro2 | 444..620 | CDD:206679 | |||
Ras | 448..602 | CDD:278499 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1464 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24072 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.050 |