DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Miro

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster


Alignment Length:197 Identity:47/197 - (23%)
Similarity:79/197 - (40%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDT 90
            ||:..|:   ::|.:|||..||||.::::....|:||| :|...:.......|.......::.|.
  Fly     5 TASQRKN---VRILLVGDAGVGKTSLILSLVSEEYPEE-VPPRAEEITIPANVTPEQVPTSIVDF 65

  Fly    91 AGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIR--------------------- 134
            :..|..|..........:...:.|::....:.:.:.|.|.|.:|                     
  Fly    66 SAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDT 130

  Fly   135 -HFSAHVPVVLVGTKLDL-RIPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVR 197
             ......|:||||.|:|| .....:..:...|.   ..||.  :.||||||...|:.::|..|.:
  Fly   131 QREPIRKPIVLVGNKIDLIEYSTMDSVLAIMED---YPEIE--SCVECSAKSLHNISEMFYYAQK 190

  Fly   198 AV 199
            ||
  Fly   191 AV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 42/184 (23%)
RHO 38..202 CDD:197554 44/185 (24%)
MiroNP_001262895.1 Miro1 10..195 CDD:206680 45/192 (23%)
RHO 14..195 CDD:197554 44/185 (24%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.