DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rhob

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001001214.1 Gene:rhob / 407883 XenbaseID:XB-GENE-478301 Length:196 Species:Xenopus tropicalis


Alignment Length:192 Identity:91/192 - (47%)
Similarity:125/192 - (65%) Gaps:16/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
            |:.:||||..||||:||.::::||||.|:||||:|:..:|.||.:...|.||||||||||:||||
 Frog     7 KLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDVKQVELALWDTAGQEDYDRLRP 71

  Fly   102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSEKF------- 159
            ||||.|:..|:|:|:.|..|.||:..||.||::||...||::||..|.|||  |.|..       
 Frog    72 LSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPSVPIILVANKKDLR--NDEHVRNELARM 134

  Fly   160 ----VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQ---SCKIL 214
                |.|::|:.|...|:||..:|||||.|:.:::|||.|.||..:|....|.:   .||:|
 Frog   135 KQEPVRTEDGRAMAVRINAFEYLECSAKTKEGVREVFETATRAALQKKHGRSGECMSCCKLL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 84/171 (49%)
RHO 38..202 CDD:197554 85/174 (49%)
rhobNP_001001214.1 RhoA_like 5..179 CDD:206662 86/173 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.