DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHOH

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001265288.1 Gene:RHOH / 399 HGNCID:686 Length:191 Species:Homo sapiens


Alignment Length:186 Identity:72/186 - (38%)
Similarity:109/186 - (58%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            :|..:|||..||||.:|:.:|...|||.|.|||::|...::.:|....:|.||||||.:.:..:|
Human     5 IKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIR 69

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRI--PNSEKFVTTQ 163
            ||||...:..|:|||:::..||.|:|:||..|||......||::|.|:.|.|.  |:....|...
Human    70 PLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAM 134

  Fly   164 EGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQ------SCKI 213
            ||||:.:::.|...:||||...:.:|||||.|||....:.:..:::      .|||
Human   135 EGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 68/163 (42%)
RHO 38..202 CDD:197554 68/165 (41%)
RHOHNP_001265288.1 Rho 5..169 CDD:206641 68/163 (42%)
Effector region. /evidence=ECO:0000250 33..41 4/7 (57%)
Interaction with ZAP70. /evidence=ECO:0000250 73..86 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.